PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 585aa    MW: 62136.6 Da    PI: 6.3306
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25644genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.16.4e-27353400552
    RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               +sl++l+ yFs+++kdAA++Lgvc+T++KriCRq+GI+RWP+Rki+++
  EMT25644 353 VSLKELQGYFSGSLKDAARSLGVCPTTMKRICRQHGISRWPFRKISKV 400
               799******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.699336422IPR003035RWP-RK domain
PfamPF020428.6E-25353400IPR003035RWP-RK domain
SuperFamilySSF542779.81E-19473545No hitNo description
PROSITE profilePS5174516.651478572IPR000270PB1 domain
SMARTSM006661.5E-18478572IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-23479545No hitNo description
CDDcd064071.51E-34479571No hitNo description
PfamPF005641.4E-12479548IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MPAWSGSSAA SASGSATATT ASGSGGGRGG GHDEADGGSG AVKERIARAL RLYKESSGAG  60
EDGGGALVQV WAPARDGERR RVLATRGQPF VLPSRCRRLL QYRTVSLTHV FAVGGGQGRR  120
VTWEERGLPG RVFEARAPEW TPNVQFYGTG EYARMSYALI YDIQASLALP ILDPAHPRRC  180
LAAVSLRGSE ICHPVPPTED AYPLAHYARM HGLAGCLAVP LRLPQSAMDV GDDDGQVEEE  240
CVVLEFFLPP DCRSAGEQKA MVDAVAATIR KECSGNHLEA TSDLQDLSLE AVLADADTAH  300
ELNDRGDYDT NDSDEEDGDQ AGGVHGADQS GAEDRVPQPE MKKKTGRKAG RPVSLKELQG  360
YFSGSLKDAA RSLGVCPTTM KRICRQHGIS RWPFRKISKV NRALGKIRAI ESADCSPKPT  420
AAASSTSRRA PAPHLPCLSS ALGEDTSSQG SSQDPPPLTK TTMRKSLLWR SNGAEGELVT  480
IKANYRGDII RFRVSCSAGV AAVKEEVAKR LGLDAGAFDV KYLDDDHEWV LLSCDADFQE  540
CLDVAPGLPA SATMAGGAGV VSPVVRLMVQ EVVADNHRSS CGSSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3643140.0AK364314.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2023L01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755490.11e-177PREDICTED: protein NLP3-like
TrEMBLM8BUM10.0M8BUM1_AEGTA; Uncharacterized protein
STRINGBRADI3G03170.11e-176(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62692939
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.16e-35Nin-like family protein